Lineage for d6e7ge_ (6e7g E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (47 species)
    not a true protein
  7. 3064715Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [364777] (2 PDB entries)
  8. 3069740Domain d6e7ge_: 6e7g E: [369802]
    Other proteins in same PDB: d6e7gb_, d6e7gd_, d6e7gf_
    automated match to d3ztna_
    complexed with bma, nag; mutant

Details for d6e7ge_

PDB Entry: 6e7g (more details), 3.09 Å

PDB Description: crystal structure of h5 hemagglutinin mutant y161a from a/viet nam/1203/2004 h5n1 influenza virus
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6e7ge_:

Sequence, based on SEQRES records: (download)

>d6e7ge_ b.19.1.0 (E:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
cigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagwllg
npmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipkssws
sheaslgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlwgihhpnd
aaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndainfes
ngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltigecp
kyvksnrlvlatglrns

Sequence, based on observed residues (ATOM records): (download)

>d6e7ge_ b.19.1.0 (E:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
cigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagwllg
npmcdevpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipksswsasl
gvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlwgihhpndaaeqtk
lyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndainfesngnfia
peyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltigecpkyvksn
rlvlatglrns

SCOPe Domain Coordinates for d6e7ge_:

Click to download the PDB-style file with coordinates for d6e7ge_.
(The format of our PDB-style files is described here.)

Timeline for d6e7ge_: