Lineage for d6dwqa_ (6dwq A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453146Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2453147Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2453148Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2453235Protein Subtilisin [52745] (7 species)
  7. 2453329Species Bacillus subtilis, carlsberg [TaxId:1423] [52746] (7 PDB entries)
  8. 3069739Domain d6dwqa_: 6dwq A: [369801]
    automated match to d1sela_
    complexed with ca, edo, no3, p5u

Details for d6dwqa_

PDB Entry: 6dwq (more details), 1.27 Å

PDB Description: subtilisin serine protease modified with the protease inhibitor cyanobenzylsulfonylfluoride
PDB Compounds: (A:) KerA

SCOPe Domain Sequences for d6dwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwqa_ c.41.1.1 (A:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgnsgstntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtxmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d6dwqa_:

Click to download the PDB-style file with coordinates for d6dwqa_.
(The format of our PDB-style files is described here.)

Timeline for d6dwqa_:

  • d6dwqa_ is new in SCOPe 2.07-stable