Lineage for d6e7gf_ (6e7g F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 3050101Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [350163] (3 PDB entries)
  8. 3069738Domain d6e7gf_: 6e7g F: [369800]
    Other proteins in same PDB: d6e7ga_, d6e7gc_, d6e7ge_
    automated match to d3m5jb_
    complexed with bma, nag; mutant

Details for d6e7gf_

PDB Entry: 6e7g (more details), 3.09 Å

PDB Description: crystal structure of h5 hemagglutinin mutant y161a from a/viet nam/1203/2004 h5n1 influenza virus
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6e7gf_:

Sequence, based on SEQRES records: (download)

>d6e7gf_ h.3.1.0 (F:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavg
refnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlr
dnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree

Sequence, based on observed residues (ATOM records): (download)

>d6e7gf_ h.3.1.0 (F:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gfieggwqgmvdgwygyhhsneqadkestqkaidgvtnkvnsiidkmntqfeavgrefnn
lerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnake
lngcfhkcdnecmesvrngtydypqyseearlkree

SCOPe Domain Coordinates for d6e7gf_:

Click to download the PDB-style file with coordinates for d6e7gf_.
(The format of our PDB-style files is described here.)

Timeline for d6e7gf_: