SCOPe 2.07: Domain d6e36a_: 6e36 A:

Lineage for d6e36a_ (6e36 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.6: V-region of surface antigen I/II (SA I/II, PAC) [74914] (1 family)
   automatically mapped to Pfam PF08363

5. Family b.30.6.1: V-region of surface antigen I/II (SA I/II, PAC) [74915] (2 proteins)

6. Protein automated matches [369791] (1 species)
   not a true protein

7. Species Streptococcus intermedius [TaxId:1338] [369792] (1 PDB entry)

8. Domain d6e36a_: 6e36 A: [369793]
   automated match to d1jmma_
   complexed with mg

Details for d6e36a_

PDB Entry: 6e36, 1.7 Å

PDB Description: the structure of the variable domain of streptococcus intermedius antigen i/ii (pas)

PDB Compounds: (A:) Probable cell-surface antigen I/II

SCOPe Domain Sequences for d6e36a_:

Sequence; same for both SEQRES and ATOM records:

>d6e36a_ b.30.6.1 (A:) automated matches {Streptococcus intermedius [TaxId: 1338]}
yeaklakyqadlakyqkdlaeypqklkeyneeqakikealkkleqdknkdghltepsaqs
lvydsepdaklslttedgtllkssvvdeafskstskakydqkilqlddldirglekadsa
tstvelygnignkstwttnvgnntevkwgsvllkrgqsvtatytnlqktyyngkkvskiv
ykytvdkdskfqnpsgnvwlgvfsdptlgvfasaytgqvekdtsifikneftfydendqp
infdnallsvaslnrennsiemakdytgkfvrisgssidekdgkiyatktlnfkkgqggs
rwtmypngqegsgwdssdapnswygagavkisgqhnsitlgaisatlvvpsdsvmavetg
kkpniwyslngkiravnvpkitkenptppveptap

Timeline for d6e36a_:

• d6e36a_ is new in SCOPe 2.07-stable
  
• d6e36a_ appears in the current release, SCOPe 2.08