Lineage for d6e36a_ (6e36 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2782262Superfamily b.30.6: V-region of surface antigen I/II (SA I/II, PAC) [74914] (1 family) (S)
    automatically mapped to Pfam PF08363
  5. 2782263Family b.30.6.1: V-region of surface antigen I/II (SA I/II, PAC) [74915] (2 proteins)
  6. 2782267Protein automated matches [369791] (1 species)
    not a true protein
  7. 2782268Species Streptococcus intermedius [TaxId:1338] [369792] (1 PDB entry)
  8. 2782269Domain d6e36a_: 6e36 A: [369793]
    automated match to d1jmma_
    complexed with mg

Details for d6e36a_

PDB Entry: 6e36 (more details), 1.7 Å

PDB Description: the structure of the variable domain of streptococcus intermedius antigen i/ii (pas)
PDB Compounds: (A:) Probable cell-surface antigen I/II

SCOPe Domain Sequences for d6e36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e36a_ b.30.6.1 (A:) automated matches {Streptococcus intermedius [TaxId: 1338]}
yeaklakyqadlakyqkdlaeypqklkeyneeqakikealkkleqdknkdghltepsaqs
lvydsepdaklslttedgtllkssvvdeafskstskakydqkilqlddldirglekadsa
tstvelygnignkstwttnvgnntevkwgsvllkrgqsvtatytnlqktyyngkkvskiv
ykytvdkdskfqnpsgnvwlgvfsdptlgvfasaytgqvekdtsifikneftfydendqp
infdnallsvaslnrennsiemakdytgkfvrisgssidekdgkiyatktlnfkkgqggs
rwtmypngqegsgwdssdapnswygagavkisgqhnsitlgaisatlvvpsdsvmavetg
kkpniwyslngkiravnvpkitkenptppveptap

SCOPe Domain Coordinates for d6e36a_:

Click to download the PDB-style file with coordinates for d6e36a_.
(The format of our PDB-style files is described here.)

Timeline for d6e36a_: