Lineage for d6e0ea1 (6e0e A:14-218)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. Protein automated matches [226839] (64 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [224896] (71 PDB entries)
  8. Domain d6e0ea1: 6e0e A:14-218 [369788]
    automated match to d5v4xa1
    complexed with glc, hkm

Details for d6e0ea1

PDB Entry: 6e0e (more details), 2.7 Å

PDB Description: crystal structure of glucokinase in complex with compound 6
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d6e0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e0ea1 c.55.1.0 (A:14-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd
flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf
ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg
dfemdvvamvndtvatmiscyyedh

SCOPe Domain Coordinates for d6e0ea1 are not available.

Timeline for d6e0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e0ea2