SCOPe 2.08: Domain d6e3oa1: 6e3o A:1-195

Lineage for d6e3oa1 (6e3o A:1-195)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)

8. Domain d6e3oa1: 6e3o A:1-195 [369786]
   Other proteins in same PDB: d6e3oa2
   automated match to d4e5ed_
   complexed with hny, mn

Details for d6e3oa1

PDB Entry: 6e3o, 3.19 Å

PDB Description: the n-terminal domain of pa endonuclease from the influenza h1n1 virus in complex with 6-(2-ethylphenyl)-3-hydroxy-4-oxo-1,4- dihydropyridine-2-carboxylic acid

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d6e3oa1:

Sequence, based on SEQRES records:

>d6e3oa1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgsgdpnall
khrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyl
ekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfr
qse

Sequence, based on observed residues (ATOM records):

>d6e3oa1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfglkhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankie
kthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse

Timeline for d6e3oa1:

• d6e3oa1 first appeared in SCOPe 2.07