SCOPe 2.08: Domain d6e55b1: 6e55 B:1-75

Lineage for d6e55b1 (6e55 B:1-75)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein automated matches [254603] (2 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [369746] (1 PDB entry)

8. Domain d6e55b1: 6e55 B:1-75 [369761]
   Other proteins in same PDB: d6e55a2, d6e55b2, d6e55c2, d6e55d2, d6e55e2, d6e55f2
   automated match to d2gcxa1

Details for d6e55b1

PDB Entry: 6e55, 1.57 Å

PDB Description: 1.57 angstroem crystal structure of feoa from klebsiella pneumoniae

PDB Compounds: (B:) FeoA protein

SCOPe Domain Sequences for d6e55b1:

Sequence; same for both SEQRES and ATOM records:

>d6e55b1 b.34.1.2 (B:1-75) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mqftpdsawkitgfsrdispayrqkllslgmlpgssfhvvrvaplgdpvhietrrvslvl
rkkdlalieleavaq

Timeline for d6e55b1:

• d6e55b1 first appeared in SCOPe 2.07