Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: FeoA-like [50041] (5 proteins) |
Protein automated matches [254603] (2 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [369746] (1 PDB entry) |
Domain d6e55b1: 6e55 B:1-75 [369761] Other proteins in same PDB: d6e55a2, d6e55b2, d6e55c2, d6e55d2, d6e55e2, d6e55f2 automated match to d2gcxa1 |
PDB Entry: 6e55 (more details), 1.57 Å
SCOPe Domain Sequences for d6e55b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e55b1 b.34.1.2 (B:1-75) automated matches {Klebsiella pneumoniae [TaxId: 573]} mqftpdsawkitgfsrdispayrqkllslgmlpgssfhvvrvaplgdpvhietrrvslvl rkkdlalieleavaq
Timeline for d6e55b1: