Lineage for d6dzxb_ (6dzx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915753Species Neisseria meningitidis [TaxId:663926] [369753] (1 PDB entry)
  8. 2915755Domain d6dzxb_: 6dzx B: [369760]
    automated match to d3ir1b_
    complexed with med

Details for d6dzxb_

PDB Entry: 6dzx (more details), 1.68 Å

PDB Description: crystal structure of the n. meningitides methionine-binding protein in its d-methionine bound conformation.
PDB Compounds: (B:) Lipoprotein

SCOPe Domain Sequences for d6dzxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dzxb_ c.94.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 663926]}
keivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkp
ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
e

SCOPe Domain Coordinates for d6dzxb_:

Click to download the PDB-style file with coordinates for d6dzxb_.
(The format of our PDB-style files is described here.)

Timeline for d6dzxb_: