Lineage for d6dwsa2 (6dws A:214-407)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. Protein automated matches [226839] (64 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [224896] (71 PDB entries)
  8. Domain d6dwsa2: 6dws A:214-407 [369757]
    automated match to d3iucc2
    complexed with hfy, mg

Details for d6dwsa2

PDB Entry: 6dws (more details), 1.9 Å

PDB Description: crystal structure of human grp78 in complex with (2r,3r,4s,5r)-2-(6- amino-8-((2-chlorobenzyl)amino)-9h-purin-9-yl)-5-(hydroxymethyl) tetrahydrofuran-3,4-diol
PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6dwsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwsa2 c.55.1.0 (A:214-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
regeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkk
tgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmd
lfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdea
vaygaavqagvlsg

SCOPe Domain Coordinates for d6dwsa2 are not available.

Timeline for d6dwsa2:

Domains from same chain:
(mouse over for more information)
d6dwsa1
Domains from other chains:
(mouse over for more information)
d6dwsb1, d6dwsb2