Lineage for d6dwsa1 (6dws A:26-213)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492889Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)
  8. 2492996Domain d6dwsa1: 6dws A:26-213 [369756]
    automated match to d5f0xa1
    complexed with hfy, mg

Details for d6dwsa1

PDB Entry: 6dws (more details), 1.9 Å

PDB Description: crystal structure of human grp78 in complex with (2r,3r,4s,5r)-2-(6- amino-8-((2-chlorobenzyl)amino)-9h-purin-9-yl)-5-(hydroxymethyl) tetrahydrofuran-3,4-diol
PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6dwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwsa1 c.55.1.0 (A:26-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
aiaygldk

SCOPe Domain Coordinates for d6dwsa1:

Click to download the PDB-style file with coordinates for d6dwsa1.
(The format of our PDB-style files is described here.)

Timeline for d6dwsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6dwsa2