SCOPe 2.07: Domain d6ds8b_: 6ds8 B:

Lineage for d6ds8b_ (6ds8 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [329909] (4 PDB entries)

8. Domain d6ds8b_: 6ds8 B: [369742]
   automated match to d4nl5b_
   complexed with cl, mnh; mutant

Details for d6ds8b_

PDB Entry: 6ds8, 2.4 Å

PDB Description: crystal structure of mhud r26s mutant with two manganese protoporphyrin ix bound per active site

PDB Compounds: (B:) Heme-degrading monooxygenase HmoB

SCOPe Domain Sequences for d6ds8b_:

Sequence; same for both SEQRES and ATOM records:

>d6ds8b_ d.58.4.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pvvkinaievpagagpelekrfahsahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvgg

Timeline for d6ds8b_:

• d6ds8b_ is new in SCOPe 2.07-stable
  
• d6ds8b_ appears in the current release, SCOPe 2.08