Lineage for d6d6if_ (6d6i F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933323Domain d6d6if_: 6d6i F: [369723]
    Other proteins in same PDB: d6d6ia_, d6d6ib_, d6d6id_, d6d6ie_
    automated match to d2l7ra_

Details for d6d6if_

PDB Entry: 6d6i (more details), 2.55 Å

PDB Description: ube2v1 in complex with ubiquitin variant ubv.v1.1 and ube2n/ubc13
PDB Compounds: (F:) Ubv.V1.1

SCOPe Domain Sequences for d6d6if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d6if_ d.15.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
ihwestlllwwrl

SCOPe Domain Coordinates for d6d6if_:

Click to download the PDB-style file with coordinates for d6d6if_.
(The format of our PDB-style files is described here.)

Timeline for d6d6if_: