Lineage for d6ds8a_ (6ds8 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. Protein automated matches [190081] (32 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [329909] (4 PDB entries)
  8. Domain d6ds8a_: 6ds8 A: [369717]
    automated match to d4nl5b_
    complexed with cl, mnh; mutant

Details for d6ds8a_

PDB Entry: 6ds8 (more details), 2.4 Å

PDB Description: crystal structure of mhud r26s mutant with two manganese protoporphyrin ix bound per active site
PDB Compounds: (A:) Heme-degrading monooxygenase HmoB

SCOPe Domain Sequences for d6ds8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ds8a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pvvkinaievpagagpelekrfahsahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvgg

SCOPe Domain Coordinates for d6ds8a_ are not available.

Timeline for d6ds8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ds8b_