Lineage for d6ducb_ (6duc B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 2481015Species Salmonella typhimurium [TaxId:90371] [189633] (16 PDB entries)
  8. 3069641Domain d6ducb_: 6duc B: [369703]
    Other proteins in same PDB: d6duca_
    automated match to d4zqcb_
    complexed with 1d0, 2ap, cl, cs, dms, edo, f9f; mutant

Details for d6ducb_

PDB Entry: 6duc (more details), 1.79 Å

PDB Description: crystal structure of mutant beta-k167t tryptophan synthase in complex with inhibitor n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1- ethylphosphate (f9f) at the alpha-site, cesium ion at the metal coordination site, and 2-aminophenol quinonoid (1d0) at the beta-site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6ducb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ducb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatltdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

SCOPe Domain Coordinates for d6ducb_:

Click to download the PDB-style file with coordinates for d6ducb_.
(The format of our PDB-style files is described here.)

Timeline for d6ducb_:

  • d6ducb_ is new in SCOPe 2.07-stable