SCOPe 2.08: Domain d6d4ea2: 6d4e A:340-444

Lineage for d6d4ea2 (6d4e A:340-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d6d4ea2: 6d4e A:340-444 [369690]
   automated match to d1hzhh4
   complexed with cl

Details for d6d4ea2

PDB Entry: 6d4e, 2.8 Å

PDB Description: crystal structure of a fc fragment of rhesus macaque (macaca mulatta) igg1.

PDB Compounds: (A:) Fc Fragment of IgG1

SCOPe Domain Sequences for d6d4ea2:

Sequence; same for both SEQRES and ATOM records:

>d6d4ea2 b.1.1.2 (A:340-444) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
kgqprepqvytlppsreeltknqvsltclvkgfypsdivvewessgqpentykttppvld
sdgsyflyskltvdksrwqqgnvfscsvmhealhnhytqkslsvs

Timeline for d6d4ea2:

• d6d4ea2 first appeared in SCOPe 2.07