Lineage for d104la_ (104l A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29167Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 29168Protein Phage T4 lysozyme [53982] (1 species)
  7. 29169Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries)
  8. 29511Domain d104la_: 104l A: [36969]

Details for d104la_

PDB Entry: 104l (more details), 2.8 Å

PDB Description: how amino-acid insertions are allowed in an alpha-helix of t4 lysozyme

SCOP Domain Sequences for d104la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d104la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaaksaaeldkaigrntngvi
tkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnsl
rmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d104la_:

Click to download the PDB-style file with coordinates for d104la_.
(The format of our PDB-style files is described here.)

Timeline for d104la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d104lb_