Lineage for d6dnzc_ (6dnz C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2470351Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2470352Protein automated matches [190689] (81 species)
    not a true protein
  7. 3069609Species Trypanosoma brucei [TaxId:185431] [369671] (1 PDB entry)
  8. 3069610Domain d6dnzc_: 6dnz C: [369672]
    automated match to d1oria_
    complexed with gol, sah, trs

Details for d6dnzc_

PDB Entry: 6dnz (more details), 2.38 Å

PDB Description: trypanosoma brucei prmt1 enzyme-prozyme heterotetrameric complex with adohcy
PDB Compounds: (C:) Arginine N-methyltransferase, putative

SCOPe Domain Sequences for d6dnzc_:

Sequence, based on SEQRES records: (download)

>d6dnzc_ c.66.1.0 (C:) automated matches {Trypanosoma brucei [TaxId: 185431]}
dsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldvgcgtgilsmfaakagarkv
igvdcstvavqareivkdngfedvitiiqgkveeiqldekvdiiisewmgyfllyesmln
tvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniwdnvqgidfsyfkrlsfiep
lvdtversqivtnvaplvsfdintvkeadlsftsefaleaqasrgkrnggnsiiyvhals
vhfdtpftaghevvildttpysppthwrqtvlylfnplrmrageratfrmkcspnalngr
dldislhvdfegalqishydqdfrlr

Sequence, based on observed residues (ATOM records): (download)

>d6dnzc_ c.66.1.0 (C:) automated matches {Trypanosoma brucei [TaxId: 185431]}
dsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldvgcgtgilsmfaakagarkv
igvdcstvavqareivkdngfedvitiiqgkveeiqldekvdiiisewmgyfllyesmln
tvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniwdnvqgidfsyfkrlsfiep
lvdtversqivtnvaplvsfdintvkeadlsftsefaleaqasiiyvhalsvhfdtpfta
ghevvildttpysppthwrqtvlylfnplrmrageratfrmkcspnalngrdldislhvd
fegalqishydqdfrlr

SCOPe Domain Coordinates for d6dnzc_:

Click to download the PDB-style file with coordinates for d6dnzc_.
(The format of our PDB-style files is described here.)

Timeline for d6dnzc_:

  • d6dnzc_ is new in SCOPe 2.07-stable