Lineage for d6d6ie_ (6d6i E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. Domain d6d6ie_: 6d6i E: [369659]
    Other proteins in same PDB: d6d6ic_, d6d6if_
    automated match to d2c2vb_

Details for d6d6ie_

PDB Entry: 6d6i (more details), 2.55 Å

PDB Description: ube2v1 in complex with ubiquitin variant ubv.v1.1 and ube2n/ubc13
PDB Compounds: (E:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d6d6ie_:

Sequence, based on SEQRES records: (download)

>d6d6ie_ d.20.1.1 (E:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamn

Sequence, based on observed residues (ATOM records): (download)

>d6d6ie_ d.20.1.1 (E:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvvidspfeggtfklelflpeeypmaa
pkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdndvaeqwk
tneaqaietarawtrlyamn

SCOPe Domain Coordinates for d6d6ie_ are not available.

Timeline for d6d6ie_:

Domains from other chains:
(mouse over for more information)
d6d6ia_, d6d6ib_, d6d6ic_, d6d6id_, d6d6if_