Lineage for d6d68d1 (6d68 D:1-72)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 2502050Species Human (Homo sapiens) [TaxId:9606] [189560] (112 PDB entries)
  8. 3069595Domain d6d68d1: 6d68 D:1-72 [369657]
    Other proteins in same PDB: d6d68c2, d6d68d2
    automated match to d5o6tc_

Details for d6d68d1

PDB Entry: 6d68 (more details), 2.36 Å

PDB Description: ube2g1 in complex with ubiquitin variant ubv.g1.1
PDB Compounds: (D:) Ubv.G1.1

SCOPe Domain Sequences for d6d68d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d68d1 d.15.1.1 (D:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvkpirvktitlevepsdtienvkakiqdkegippdqqrlifsgklledgrtlsdyn
iqkeytlhlllr

SCOPe Domain Coordinates for d6d68d1:

Click to download the PDB-style file with coordinates for d6d68d1.
(The format of our PDB-style files is described here.)

Timeline for d6d68d1:

  • d6d68d1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6d68d2