Lineage for d6d68c1 (6d68 C:1-74)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932580Domain d6d68c1: 6d68 C:1-74 [369654]
    Other proteins in same PDB: d6d68c2, d6d68d2
    automated match to d5o6tc_

Details for d6d68c1

PDB Entry: 6d68 (more details), 2.36 Å

PDB Description: ube2g1 in complex with ubiquitin variant ubv.g1.1
PDB Compounds: (C:) Ubv.G1.1

SCOPe Domain Sequences for d6d68c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d68c1 d.15.1.1 (C:1-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvkpirvktitlevepsdtienvkakiqdkegippdqqrlifsgklledgrtlsdyn
iqkeytlhlllrrh

SCOPe Domain Coordinates for d6d68c1:

Click to download the PDB-style file with coordinates for d6d68c1.
(The format of our PDB-style files is described here.)

Timeline for d6d68c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6d68c2