Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (397 PDB entries) many mutant structures |
Domain d169lc_: 169l C: [36965] |
PDB Entry: 169l (more details), 3 Å
SCOP Domain Sequences for d169lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d169lc_ d.2.1.3 (C:) Phage T4 lysozyme {Bacteriophage T4} mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm lqqkrwdaaaaalaaaawaaatpnrakrvittfrtgtwdayk
Timeline for d169lc_:
View in 3D Domains from other chains: (mouse over for more information) d169la_, d169lb_, d169ld_, d169le_ |