Lineage for d6c9oa1 (6c9o A:3-56)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934672Species Streptococcus sp. [TaxId:1320] [193546] (13 PDB entries)
  8. 2934676Domain d6c9oa1: 6c9o A:3-56 [369645]
    Other proteins in same PDB: d6c9oa2, d6c9ob2
    automated match to d2qmta_
    complexed with mpd; mutant

Details for d6c9oa1

PDB Entry: 6c9o (more details), 1.2 Å

PDB Description: selenomethionine mutant (v29sem) of protein gb1 examined by x-ray diffraction
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d6c9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c9oa1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklilngktlkgettteavdaataekmfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d6c9oa1:

Click to download the PDB-style file with coordinates for d6c9oa1.
(The format of our PDB-style files is described here.)

Timeline for d6c9oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c9oa2