Lineage for d6a2ca2 (6a2c A:237-565)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. Protein automated matches [196409] (46 species)
    not a true protein
  7. Species Santalum album [TaxId:35974] [367260] (11 PDB entries)
  8. Domain d6a2ca2: 6a2c A:237-565 [369636]
    Other proteins in same PDB: d6a2ca1, d6a2cb1
    automated match to d3m00a2
    complexed with fpp, mg

Details for d6a2ca2

PDB Entry: 6a2c (more details), 1.94 Å

PDB Description: crystal structure of a synthase 2 from santalum album in complex with lig2
PDB Compounds: (A:) Sesquisabinene B synthase 2

SCOPe Domain Sequences for d6a2ca2:

Sequence, based on SEQRES records: (download)

>d6a2ca2 a.128.1.0 (A:237-565) automated matches {Santalum album [TaxId: 35974]}
vnltllryakldfnivqsfhqkeigrlsrwwvgtgldkmpfarngliqsymyaigmlfep
nlgevremeakvgalittiddvydvygtmeelelftditnrwdiskadqlprnirmpllt
mfntsndigywalkergfngipctakvwsdqlksytkeakwfheghkptleeyldnalvs
igfpnllvtsylltvenptkekldyvnslplfvrascilcriindlgtspdemergdnlk
siqcymneagasqevarehieglvrmwwkrlnkclfepspfaepflsftvnvvrgshffy
qygdgygnaeswtkkqgmsvlihpiplne

Sequence, based on observed residues (ATOM records): (download)

>d6a2ca2 a.128.1.0 (A:237-565) automated matches {Santalum album [TaxId: 35974]}
vnltllryakldfnivqsfhqkeigrlsrwwvgtgldkmpfarngliqsymyaigmlfep
nlgevremeakvgalittiddvydvygtmeelelftditnrwdiskadqlprnirmpllt
mfntsndigywalkergfngipctakvwsdqlksytkeakwfheghkptleeyldnalvs
igfpnllvtsylltvenptkekldyvnslplfvrascilcriindlgtspdednlksiqc
ymneagasqevarehieglvrmwwkrlnkclfepspfaepflsftvnvvrgshffyqyae
swtkkqgmsvlihpiplne

SCOPe Domain Coordinates for d6a2ca2 are not available.

Timeline for d6a2ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a2ca1
View in 3D
Domains from other chains:
(mouse over for more information)
d6a2cb1, d6a2cb2