Lineage for d6d6ic_ (6d6i C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (31 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 3069568Domain d6d6ic_: 6d6i C: [369630]
    Other proteins in same PDB: d6d6ia_, d6d6ib_, d6d6id_, d6d6ie_
    automated match to d2l7ra_

Details for d6d6ic_

PDB Entry: 6d6i (more details), 2.55 Å

PDB Description: ube2v1 in complex with ubiquitin variant ubv.v1.1 and ube2n/ubc13
PDB Compounds: (C:) Ubv.V1.1

SCOPe Domain Sequences for d6d6ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d6ic_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
ihwestlllwwrl

SCOPe Domain Coordinates for d6d6ic_:

Click to download the PDB-style file with coordinates for d6d6ic_.
(The format of our PDB-style files is described here.)

Timeline for d6d6ic_:

  • d6d6ic_ is new in SCOPe 2.07-stable