Lineage for d6a3ka_ (6a3k A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311591Family a.24.3.0: automated matches [271165] (1 protein)
    not a true family
  6. 2311592Protein automated matches [271167] (4 species)
    not a true protein
  7. 3069564Species Shewanella benthica [TaxId:126830] [369626] (1 PDB entry)
  8. 3069565Domain d6a3ka_: 6a3k A: [369627]
    automated match to d4ulva_
    complexed with 1pe, hem

Details for d6a3ka_

PDB Entry: 6a3k (more details), 1.71 Å

PDB Description: crystal structure of cytochrome c' from shewanella benthica db6705
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d6a3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a3ka_ a.24.3.0 (A:) automated matches {Shewanella benthica [TaxId: 126830]}
snfkeaddaihyrqsafslmahnfgdmgamlkgkkpfdseifamraqnvaalsklplegf
ipgsdqgetealakiwteksdfdakmktlqdnaaalllasasddkkllkqsfmqvaksck
gchdvykkd

SCOPe Domain Coordinates for d6a3ka_:

Click to download the PDB-style file with coordinates for d6a3ka_.
(The format of our PDB-style files is described here.)

Timeline for d6a3ka_:

  • d6a3ka_ is new in SCOPe 2.07-stable