SCOPe 2.07: Domain d6chea1: 6che A:3-56

Lineage for d6chea1 (6che A:3-56)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)

8. Domain d6chea1: 6che A:3-56 [369624]
   Other proteins in same PDB: d6chea2
   automated match to d2qmta_
   complexed with imd, mpd; mutant

Details for d6chea1

PDB Entry: 6che, 1.1 Å

PDB Description: selenomethionine mutant (a34sem) of protein gb1 examined by x-ray diffraction

PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d6chea1:

Sequence; same for both SEQRES and ATOM records:

>d6chea1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklilngktlkgettteavdaataekvfkqymndngvdgewtyddatktftvte

Timeline for d6chea1:

• d6chea1 is new in SCOPe 2.07-stable
  
• d6chea1 appears in the current release, SCOPe 2.08