Lineage for d6a1ia1 (6a1i A:34-236)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. Protein automated matches [226931] (12 species)
    not a true protein
  7. Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. Domain d6a1ia1: 6a1i A:34-236 [369614]
    Other proteins in same PDB: d6a1ia2
    automated match to d2onha1
    complexed with co3, gol, ni, so4

Details for d6a1ia1

PDB Entry: 6a1i (more details), 1.6 Å

PDB Description: crystal structure of a synthase 1 from santalum album
PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6a1ia1:

Sequence, based on SEQRES records: (download)

>d6a1ia1 a.102.4.0 (A:34-236) automated matches {Santalum album [TaxId: 35974]}
anlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglky
qfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfk
nelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldl
plhwrairyearwfidiyedeed

Sequence, based on observed residues (ATOM records): (download)

>d6a1ia1 a.102.4.0 (A:34-236) automated matches {Santalum album [TaxId: 35974]}
nlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyq
fetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfkn
elcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldlp
lhwrairyearwfidiyedeed

SCOPe Domain Coordinates for d6a1ia1 are not available.

Timeline for d6a1ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a1ia2