Lineage for d178l__ (178l -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries) 
Domain d178l__: 178l - [36961]
Details for d178l__
PDB Entry: 178l (more details), 2.7 Å
PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
SCOP Domain Sequences for d178l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d178l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwceaavnlaksrwynqtpnrakrvittfctgtwdayk
SCOP Domain Coordinates for d178l__:
Click to download the PDB-style file with coordinates for d178l__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d178l__:
- d178l__ first appeared (with stable ids) in SCOP 1.55
- d178l__ appears in SCOP 1.59
- d178l__ appears in the current release, SCOPe 2.08, called d178la_
View in 3D