Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Delftia acidovorans [TaxId:80866] [369588] (4 PDB entries) |
Domain d5bkbb_: 5bkb B: [369602] automated match to d1otja_ complexed with akg, ftv, mn, peg, so4 |
PDB Entry: 5bkb (more details), 1.58 Å
SCOPe Domain Sequences for d5bkbb_:
Sequence, based on SEQRES records: (download)
>d5bkbb_ b.82.2.0 (B:) automated matches {Delftia acidovorans [TaxId: 80866]} rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf srrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldappaavvmraid vpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrrfsntsvkvm dvdagdretvhplvvthpgsgrkglyvnqvycqriegmtdaeskpllqflyehatrfdft crvrwkkdqvlvwdnlctmhravpdyagkfryltrttvggvrpar
>d5bkbb_ b.82.2.0 (B:) automated matches {Delftia acidovorans [TaxId: 80866]} rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf srrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldappaavvmraid vpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgsldagdretvhplvvthp gsgrkglyvnqvycqriegmtdaeskpllqflyehatrfdftcrvrwkkdqvlvwdnlct mhravpdyagkfryltrttvggvrpar
Timeline for d5bkbb_: