Lineage for d189l__ (189l -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76503Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 76504Protein Phage T4 lysozyme [53982] (1 species)
  7. 76505Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)
  8. 76857Domain d189l__: 189l - [36960]

Details for d189l__

PDB Entry: 189l (more details), 2.5 Å

PDB Description: enhancement of protein stability by the combination of point mutations in t4 lysozyme is additive

SCOP Domain Sequences for d189l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d189l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnlfemlrideglrlkiykdtegyytigighlltkspdlnvakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnpklkpvydsldavrrcalinmvfqmgetgvagftdslrm
lqqkrwdeaaanlaksrwynqtpdrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d189l__:

Click to download the PDB-style file with coordinates for d189l__.
(The format of our PDB-style files is described here.)

Timeline for d189l__: