Lineage for d189la_ (189l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2925652Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2925658Protein Phage T4 lysozyme [53982] (1 species)
  7. 2925659Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2926299Domain d189la_: 189l A: [36960]
    mutant

Details for d189la_

PDB Entry: 189l (more details), 2.5 Å

PDB Description: enhancement of protein stability by the combination of point mutations in t4 lysozyme is additive
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d189la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d189la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnlfemlrideglrlkiykdtegyytigighlltkspdlnvakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnpklkpvydsldavrrcalinmvfqmgetgvagftdslrm
lqqkrwdeaaanlaksrwynqtpdrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d189la_:

Click to download the PDB-style file with coordinates for d189la_.
(The format of our PDB-style files is described here.)

Timeline for d189la_: