Lineage for d6aa1b_ (6aa1 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Liberibacter asiaticus [TaxId:537021] [369512] (4 PDB entries)
  8. Domain d6aa1b_: 6aa1 B: [369596]
    automated match to d4ohna_
    complexed with cit, edo, gol, peg

Details for d6aa1b_

PDB Entry: 6aa1 (more details), 1.86 Å

PDB Description: crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus bound with citrate
PDB Compounds: (B:) Putative amino acid-binding periplasmic ABC transporter protein

SCOPe Domain Sequences for d6aa1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa1b_ c.94.1.0 (B:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss

SCOPe Domain Coordinates for d6aa1b_ are not available.

Timeline for d6aa1b_:

Domains from other chains:
(mouse over for more information)
d6aa1a_