Lineage for d6a8sa_ (6a8s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915662Species Liberibacter asiaticus [TaxId:537021] [369512] (4 PDB entries)
  8. 2915667Domain d6a8sa_: 6a8s A: [369586]
    automated match to d4ohna_
    complexed with act, cys, edo, gol, so4, trs

Details for d6a8sa_

PDB Entry: 6a8s (more details), 2.05 Å

PDB Description: crystal structure of the putative amino acid-binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cysteine
PDB Compounds: (A:) Putative amino acid-binding periplasmic ABC transporter protein

SCOPe Domain Sequences for d6a8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8sa_ c.94.1.0 (A:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
salrvgtdgiypphsfhaqdgrgeltgfdidlikevahrlnlkveffetavsglitgldt
nrydvlvnvaitperqkkydfsipyiahrvllvvrsdqqdirsfkdltdktvaqilgtdl
srfakelkshlvfshnfeqslqlllskrtdatmipdipffnflerrphdgnlfkiadrmk
dnsavafmmrkgnnkltrsineilcaihldgtykkifdryfdkniissvpgcss

SCOPe Domain Coordinates for d6a8sa_:

Click to download the PDB-style file with coordinates for d6a8sa_.
(The format of our PDB-style files is described here.)

Timeline for d6a8sa_: