Lineage for d177la_ (177l A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850692Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 850698Protein Phage T4 lysozyme [53982] (1 species)
  7. 850699Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 851152Domain d177la_: 177l A: [36958]
    mutant

Details for d177la_

PDB Entry: 177l (more details), 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOP Domain Sequences for d177la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d177la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwceaavnlaksrwynqtpnrakrvittfctgtwdayk

SCOP Domain Coordinates for d177la_:

Click to download the PDB-style file with coordinates for d177la_.
(The format of our PDB-style files is described here.)

Timeline for d177la_: