Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Cutibacterium acnes [TaxId:1747] [369559] (1 PDB entry) |
Domain d6a9nb1: 6a9n B:2-184 [369576] automated match to d1mzja1 complexed with gol, k |
PDB Entry: 6a9n (more details), 2.1 Å
SCOPe Domain Sequences for d6a9nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a9nb1 c.95.1.0 (B:2-184) automated matches {Cutibacterium acnes [TaxId: 1747]} taiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnsetv asmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdlnga aagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigasde pgi
Timeline for d6a9nb1: