Lineage for d6a9nb1 (6a9n B:2-184)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524867Species Cutibacterium acnes [TaxId:1747] [369559] (1 PDB entry)
  8. 2524870Domain d6a9nb1: 6a9n B:2-184 [369576]
    automated match to d1mzja1
    complexed with gol, k

Details for d6a9nb1

PDB Entry: 6a9n (more details), 2.1 Å

PDB Description: crystal structure of kas iii from propionibacterium acnes
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d6a9nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a9nb1 c.95.1.0 (B:2-184) automated matches {Cutibacterium acnes [TaxId: 1747]}
taiktrpvhgyskflstgsargsrvvtnkemctlidstpewieqrtgiterrwatnsetv
asmgttaartalersgleasqidaiivatvshhrpspslaayiarelglgdaaafdlnga
aagfcystaladsmirtgsanyvlvigveklsemtnlddrstaflfsdgagaaiigasde
pgi

SCOPe Domain Coordinates for d6a9nb1:

Click to download the PDB-style file with coordinates for d6a9nb1.
(The format of our PDB-style files is described here.)

Timeline for d6a9nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a9nb2