Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Enterococcus faecalis [TaxId:565637] [279343] (3 PDB entries) |
Domain d6a8td_: 6a8t D: [369575] automated match to d4wl3a_ mutant |
PDB Entry: 6a8t (more details), 2.1 Å
SCOPe Domain Sequences for d6a8td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a8td_ d.153.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 565637]} ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk enlekdslivypmvetqqinyan
Timeline for d6a8td_: