SCOPe 2.07: Domain d6a8oa_: 6a8o A:

Lineage for d6a8oa_ (6a8o A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188816] (5 PDB entries)

8. Domain d6a8oa_: 6a8o A: [369565]
   automated match to d5gvta_
   complexed with man, mrz

Details for d6a8oa_

PDB Entry: 6a8o, 2.77 Å

PDB Description: crystal structures of the serine protease domain of murine plasma kallikrein with peptide inhibitor mupain-1-16

PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d6a8oa_:

Sequence; same for both SEQRES and ATOM records:

>d6a8oa_ b.47.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq

Timeline for d6a8oa_:

• d6a8oa_ is new in SCOPe 2.07-stable
  
• d6a8oa_ appears in the current release, SCOPe 2.08