Lineage for d6a8oa_ (6a8o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2797049Species Mouse (Mus musculus) [TaxId:10090] [188816] (5 PDB entries)
  8. 2797060Domain d6a8oa_: 6a8o A: [369565]
    automated match to d5gvta_
    complexed with man, mrz

Details for d6a8oa_

PDB Entry: 6a8o (more details), 2.77 Å

PDB Description: crystal structures of the serine protease domain of murine plasma kallikrein with peptide inhibitor mupain-1-16
PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d6a8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8oa_ b.47.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivggtnaslgewpwqvslqvklvsqthlcggsiigrqwvltaahcfdgipypdvwriygg
ilslseitketpssrikeliihqeykvsegnydialiklqtplnytefqkpislpskadt
ntiytncwvtgwgytkeqgetqnilqkatiplvpneecqkkyrdyvinkqmicagykegg
tdackgdsggplvckhsgrwqlvgitswgegcarkdqpgvytkvseymdwilektq

SCOPe Domain Coordinates for d6a8oa_:

Click to download the PDB-style file with coordinates for d6a8oa_.
(The format of our PDB-style files is described here.)

Timeline for d6a8oa_: