Lineage for d6a2db1 (6a2d B:34-236)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722880Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. 2722887Domain d6a2db1: 6a2d B:34-236 [369553]
    Other proteins in same PDB: d6a2da2, d6a2db2
    automated match to d3lz9a1
    complexed with 6r2, mg

Details for d6a2db1

PDB Entry: 6a2d (more details), 1.96 Å

PDB Description: crystal structure of a synthase 2 from santalum album in complex with ligand1
PDB Compounds: (B:) Sesquisabinene B synthase 2

SCOPe Domain Sequences for d6a2db1:

Sequence, based on SEQRES records: (download)

>d6a2db1 a.102.4.0 (B:34-236) automated matches {Santalum album [TaxId: 35974]}
yppnlwdyeflqslgdqctveekhlkladklkeevkslikqtmepltklefidtvrrlgl
kyqfetevkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgfk
nqlcedvkgllslyeasflgwegedildeartfatsklksiegkipspslakkvshaldl
plhwrtiryearwfidtyeeeed

Sequence, based on observed residues (ATOM records): (download)

>d6a2db1 a.102.4.0 (B:34-236) automated matches {Santalum album [TaxId: 35974]}
yppnlwdyeflqslgdhlkladklkeevkslikqtmepltklefidtvrrlglkyqfete
vkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgfknqlcedv
kgllslyeasflgwegedildeartfatsklksiegkipspslakkvshaldlplhwrti
ryearwfidtyeeeed

SCOPe Domain Coordinates for d6a2db1:

Click to download the PDB-style file with coordinates for d6a2db1.
(The format of our PDB-style files is described here.)

Timeline for d6a2db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a2db2