SCOPe 2.08: Domain d6a06b1: 6a06 B:152-340

Lineage for d6a06b1 (6a06 B:152-340)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein automated matches [254746] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [369485] (5 PDB entries)

8. Domain d6a06b1: 6a06 B:152-340 [369543]
   Other proteins in same PDB: d6a06a2, d6a06b2
   automated match to d4f5wa_
   complexed with 1sy, so4

Details for d6a06b1

PDB Entry: 6a06, 1.79 Å

PDB Description: structure of psting complex

PDB Compounds: (B:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d6a06b1:

Sequence, based on SEQRES records:

>d6a06b1 d.387.1.1 (B:152-340) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
nfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvpdd
lsvadpnirflhelpqqsadragikgrvytnsiyellengqpagvcvleyatplqtlfam
sqdgragfsredrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqeilr
hlrqeerev

Sequence, based on observed residues (ATOM records):

>d6a06b1 d.387.1.1 (B:152-340) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
nfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvpdd
lsvadpnirflhelpqgrvytnsiyellengqpagvcvleyatplqtlfamsqdgragfs
redrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqeilrhlrqeerev

Timeline for d6a06b1:

• d6a06b1 first appeared in SCOPe 2.07