SCOPe 2.08: Domain d6a8da1: 6a8d A:1-179

Lineage for d6a8da1 (6a8d A:1-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [369535] (1 PDB entry)

8. Domain d6a8da1: 6a8d A:1-179 [369536]
   Other proteins in same PDB: d6a8da2
   automated match to d3lrpa_
   complexed with gdp, mg, so4

Details for d6a8da1

PDB Entry: 6a8d, 2.34 Å

PDB Description: crystal structure of chlamydomonas reinhardtii arf

PDB Compounds: (A:) ARF/SAR superfamily small monomeric GTP binding protein

SCOPe Domain Sequences for d6a8da1:

Sequence; same for both SEQRES and ATOM records:

>d6a8da1 c.37.1.8 (A:1-179) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mgqaftklfdrwfgnremrvvmlgldaagkttilyklhigevlttvptigfnvekvqykn
vvftvwdvggqeklrplwrhyfnntdglifvvdsqdrdrigkaaqefqailqdplmlhsa
ilvfankqdmkgcltpaevctalglsdmrtrkwhvqssvatrgeglyegldwlattlkn

Timeline for d6a8da1:

• d6a8da1 first appeared in SCOPe 2.07