| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
| Protein automated matches [226931] (11 species) not a true protein |
| Species Santalum album [TaxId:35974] [367258] (11 PDB entries) |
| Domain d6a2ab1: 6a2a B:33-236 [369518] Other proteins in same PDB: d6a2aa2, d6a2ab2 automated match to d3lz9a1 |
PDB Entry: 6a2a (more details), 1.77 Å
SCOPe Domain Sequences for d6a2ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a2ab1 a.102.4.0 (B:33-236) automated matches {Santalum album [TaxId: 35974]}
nyppnlwdyeflqslgdqctveekhlkladklkeevkslikqtmepltklefidtvrrlg
lkyqfetevkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgf
knqlcedvkgllslyeasflgwegedildeartfatsklksiegkipspslakkvshald
lplhwrtiryearwfidtyeeeed
Timeline for d6a2ab1: