Lineage for d6a2ab1 (6a2a B:33-236)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. Protein automated matches [226931] (12 species)
    not a true protein
  7. Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. Domain d6a2ab1: 6a2a B:33-236 [369518]
    Other proteins in same PDB: d6a2aa2, d6a2ab2
    automated match to d3lz9a1

Details for d6a2ab1

PDB Entry: 6a2a (more details), 1.7700000000000002 Å

PDB Description: crystal structure of a synthase 2 from santalum album
PDB Compounds: (B:) Sesquisabinene B synthase 2

SCOPe Domain Sequences for d6a2ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a2ab1 a.102.4.0 (B:33-236) automated matches {Santalum album [TaxId: 35974]}
nyppnlwdyeflqslgdqctveekhlkladklkeevkslikqtmepltklefidtvrrlg
lkyqfetevkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgf
knqlcedvkgllslyeasflgwegedildeartfatsklksiegkipspslakkvshald
lplhwrtiryearwfidtyeeeed

SCOPe Domain Coordinates for d6a2ab1 are not available.

Timeline for d6a2ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a2ab2
View in 3D
Domains from other chains:
(mouse over for more information)
d6a2aa1, d6a2aa2