Lineage for d6a7aa_ (6a7a A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. Protein automated matches [190169] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188399] (46 PDB entries)
  8. Domain d6a7aa_: 6a7a A: [369496]
    automated match to d2fgba_
    complexed with 9s0, nap

Details for d6a7aa_

PDB Entry: 6a7a (more details), 2.3699999999999997 Å

PDB Description: akr1c1 complexed with new inhibitor with novel scaffold
PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d6a7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a7aa_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvsvkpg
eevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnvry
ltldifagppnypfsdey

SCOPe Domain Coordinates for d6a7aa_ are not available.

Timeline for d6a7aa_: