Lineage for d6a4ha_ (6a4h A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. Protein automated matches [190048] (31 species)
    not a true protein
  7. Species Amycolatopsis orientalis [TaxId:31958] [369467] (41 PDB entries)
  8. Domain d6a4ha_: 6a4h A: [369488]
    automated match to d1gyla_
    complexed with 9qf; mutant

Details for d6a4ha_

PDB Entry: 6a4h (more details), 1.99 Å

PDB Description: mandelate oxidase mutant-y128f with the peroxide fmn adduct
PDB Compounds: (A:) 4-hydroxymandelate oxidase

SCOPe Domain Sequences for d6a4ha_:

Sequence, based on SEQRES records: (download)

>d6a4ha_ c.1.4.0 (A:) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
ladleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltdvtteidif
grraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeiaavggrpwf
qlfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewvtaanfdag
taahrrtqgvsavadhtarefapatwesveavrahtdlpvvlkgilavedarravdagag
givvsnhggrqldgavpgiemlgeivaavsggcevlvdggirsggdvlkatalgasavlv
grpvmwalaaagqdgvrqllellaeevrdamglagcesvgaarrlntklgv

Sequence, based on observed residues (ATOM records): (download)

>d6a4ha_ c.1.4.0 (A:) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
ladleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltdvtteidif
grraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeiaavggrpwf
qlfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewvtaanfdfa
patwesveavrahtdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgieml
geivaavsggcevlvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrqllel
laeevrdamglagcesvgaarrlntklgv

SCOPe Domain Coordinates for d6a4ha_ are not available.

Timeline for d6a4ha_: