Lineage for d6a3aa_ (6a3a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867618Protein Ran [52609] (2 species)
  7. 2867639Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)
  8. 2867683Domain d6a3aa_: 6a3a A: [369464]
    Other proteins in same PDB: d6a3ab_
    automated match to d2mmca_
    complexed with edo, gol, gtp, mg, na; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d6a3aa_

PDB Entry: 6a3a (more details), 2.3 Å

PDB Description: mvm nes mutant nm2 in complex with crm1-ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d6a3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a3aa_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
vvmdpalaaqaehdlevaqttalpdedddl

SCOPe Domain Coordinates for d6a3aa_:

Click to download the PDB-style file with coordinates for d6a3aa_.
(The format of our PDB-style files is described here.)

Timeline for d6a3aa_: