Lineage for d6a38b_ (6a38 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2394985Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (41 PDB entries)
  8. 3069399Domain d6a38b_: 6a38 B: [369461]
    Other proteins in same PDB: d6a38a_
    automated match to d5uwsb_
    complexed with edo, gol, gtp, mg, na

Details for d6a38b_

PDB Entry: 6a38 (more details), 2.69 Å

PDB Description: mvm ns2 nes in complex with crm1-ran-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d6a38b_:

Sequence, based on SEQRES records: (download)

>d6a38b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvr
ilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsken
adkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records): (download)

>d6a38b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdkt
lkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeef
ekaqeinkk

SCOPe Domain Coordinates for d6a38b_:

Click to download the PDB-style file with coordinates for d6a38b_.
(The format of our PDB-style files is described here.)

Timeline for d6a38b_: