Lineage for d6q2wa_ (6q2w A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343210Species Nomascus leucogenys [TaxId:61853] [335245] (17 PDB entries)
  8. 2343219Domain d6q2wa_: 6q2w A: [369452]
    automated match to d5x8sb_
    complexed with hbw

Details for d6q2wa_

PDB Entry: 6q2w (more details), 1.99 Å

PDB Description: crystal structure of human ror gamma lbd in complex with a quinoline sulfonamide inverse agonist
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6q2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q2wa_ a.123.1.0 (A:) automated matches {Nomascus leucogenys [TaxId: 61853]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlckthrqsilaklppkgklrslcsqhverlqifq

SCOPe Domain Coordinates for d6q2wa_:

Click to download the PDB-style file with coordinates for d6q2wa_.
(The format of our PDB-style files is described here.)

Timeline for d6q2wa_: