SCOPe 2.06: Domain d1b6ia_: 1b6i A:

Lineage for d1b6ia_ (1b6i A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1b6ia_: 1b6i A: [36945]
   complexed with hed; mutant

Details for d1b6ia_

PDB Entry: 1b6i, 1.9 Å

PDB Description: t4 lysozyme mutant with cys 54 replaced by thr, cys 97 replaced by ala, thr 21 replaced by cys and lys 124 replaced by cys (c54t,c97a, t21c,k124c)

PDB Compounds: (A:) protein (lysozyme)

SCOPe Domain Sequences for d1b6ia_:

Sequence; same for both SEQRES and ATOM records:

>d1b6ia_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqcrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1b6ia_:

• d1b6ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6ia_ appears in SCOPe 2.05
  
• d1b6ia_ appears in SCOPe 2.07
  
• d1b6ia_ appears in the current release, SCOPe 2.08